Anti FAT4 pAb (ATL-HPA052819)

Atlas Antibodies

Catalog No.:
ATL-HPA052819-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FAT atypical cadherin 4
Gene Name: FAT4
Alternative Gene Name: CDHF14, CDHR11, FAT-J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046743: 97%, ENSRNOG00000028335: 97%
Entrez Gene ID: 79633
Uniprot ID: Q6V0I7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
Gene Sequence FDDPDNIPPYGDDMTVRKQPEGNPKPDIIERENPYLIYDETDIPHNSETIPSAPLASPEQEIEHYDIDNASSIAPSDADIIQHYKQFRSHT
Gene ID - Mouse ENSMUSG00000046743
Gene ID - Rat ENSRNOG00000028335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAT4 pAb (ATL-HPA052819)
Datasheet Anti FAT4 pAb (ATL-HPA052819) Datasheet (External Link)
Vendor Page Anti FAT4 pAb (ATL-HPA052819) at Atlas Antibodies

Documents & Links for Anti FAT4 pAb (ATL-HPA052819)
Datasheet Anti FAT4 pAb (ATL-HPA052819) Datasheet (External Link)
Vendor Page Anti FAT4 pAb (ATL-HPA052819)
Citations for Anti FAT4 pAb (ATL-HPA052819) – 1 Found
Ma, Liangang; Cui, Jianxin; Xi, Hongqing; Bian, Shibo; Wei, Bo; Chen, Lin. Fat4 suppression induces Yap translocation accounting for the promoted proliferation and migration of gastric cancer cells. Cancer Biology & Therapy. 17(1):36-47.  PubMed