Anti FASTKD3 pAb (ATL-HPA068525)

Atlas Antibodies

Catalog No.:
ATL-HPA068525-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FAST kinase domains 3
Gene Name: FASTKD3
Alternative Gene Name: FLJ23274, MGC5297
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021532: 76%, ENSRNOG00000027422: 76%
Entrez Gene ID: 79072
Uniprot ID: Q14CZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWL
Gene Sequence DEEGFVLPSTANEDIHKRIALCIDGPKRFCSNSKHLLGKEAIKQRHLQLLGYQVVQIPYHEIGMLKSRRELVEYLQRKLFSQNTVHWL
Gene ID - Mouse ENSMUSG00000021532
Gene ID - Rat ENSRNOG00000027422
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FASTKD3 pAb (ATL-HPA068525)
Datasheet Anti FASTKD3 pAb (ATL-HPA068525) Datasheet (External Link)
Vendor Page Anti FASTKD3 pAb (ATL-HPA068525) at Atlas Antibodies

Documents & Links for Anti FASTKD3 pAb (ATL-HPA068525)
Datasheet Anti FASTKD3 pAb (ATL-HPA068525) Datasheet (External Link)
Vendor Page Anti FASTKD3 pAb (ATL-HPA068525)