Anti FASTKD2 pAb (ATL-HPA067191)

Atlas Antibodies

SKU:
ATL-HPA067191-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria & cytokinetic bridge.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FAST kinase domains 2
Gene Name: FASTKD2
Alternative Gene Name: KIAA0971
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025962: 76%, ENSRNOG00000023923: 76%
Entrez Gene ID: 22868
Uniprot ID: Q9NYY8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY
Gene Sequence QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY
Gene ID - Mouse ENSMUSG00000025962
Gene ID - Rat ENSRNOG00000023923
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FASTKD2 pAb (ATL-HPA067191)
Datasheet Anti FASTKD2 pAb (ATL-HPA067191) Datasheet (External Link)
Vendor Page Anti FASTKD2 pAb (ATL-HPA067191) at Atlas Antibodies

Documents & Links for Anti FASTKD2 pAb (ATL-HPA067191)
Datasheet Anti FASTKD2 pAb (ATL-HPA067191) Datasheet (External Link)
Vendor Page Anti FASTKD2 pAb (ATL-HPA067191)