Anti FASTKD1 pAb (ATL-HPA043719)

Atlas Antibodies

Catalog No.:
ATL-HPA043719-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FAST kinase domains 1
Gene Name: FASTKD1
Alternative Gene Name: FLJ21901
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027086: 69%, ENSRNOG00000024335: 64%
Entrez Gene ID: 79675
Uniprot ID: Q53R41
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDA
Gene Sequence GSHNIALGQLPEMPWESNIEIVGSRLPPGAERIALEFLDSKALCRNIPHMKGKSAMKKRHLEILGYRVIQISQFEWNSMALSTKDA
Gene ID - Mouse ENSMUSG00000027086
Gene ID - Rat ENSRNOG00000024335
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FASTKD1 pAb (ATL-HPA043719)
Datasheet Anti FASTKD1 pAb (ATL-HPA043719) Datasheet (External Link)
Vendor Page Anti FASTKD1 pAb (ATL-HPA043719) at Atlas Antibodies

Documents & Links for Anti FASTKD1 pAb (ATL-HPA043719)
Datasheet Anti FASTKD1 pAb (ATL-HPA043719) Datasheet (External Link)
Vendor Page Anti FASTKD1 pAb (ATL-HPA043719)