Anti FASN pAb (ATL-HPA006461 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA006461-25

• 
• 
• 

Protein Description: fatty acid synthase
Gene Name: FASN
Alternative Gene Name: FAS, SDR27X1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025153: 64%, ENSRNOG00000045636: 68%
Entrez Gene ID: 2194
Uniprot ID: P49327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGN
• Gene Sequence: RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGN
• Gene ID - Mouse: ENSMUSG00000025153
• Gene ID - Rat: ENSRNOG00000045636
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FASN pAb (ATL-HPA006461 w/enhanced validation) – 2 Found

Ramdhave, Anup S; Ojha, Shreesh; Nandave, Mukesh. Energy intake correlates with the levels of fatty acid synthase and insulin-like growth factor-1 in male and female C57BL/6 mice. American Journal Of Translational Research. 9(3):830-844. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.