Anti FASN pAb (ATL-HPA006461 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006461-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FASN
Alternative Gene Name: FAS, SDR27X1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025153: 64%, ENSRNOG00000045636: 68%
Entrez Gene ID: 2194
Uniprot ID: P49327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGN |
| Gene Sequence | RWLRVTVAGGVHISGLHTESAPRRQQEQQVPILEKFCFTPHTEEGCLSERAALQEELQLCKGLVQALQTKVTQQGLKMVVPGLDGAQIPRDPSQQELPRLLSAACRLQLNGN |
| Gene ID - Mouse | ENSMUSG00000025153 |
| Gene ID - Rat | ENSRNOG00000045636 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FASN pAb (ATL-HPA006461 w/enhanced validation) | |
| Datasheet | Anti FASN pAb (ATL-HPA006461 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FASN pAb (ATL-HPA006461 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FASN pAb (ATL-HPA006461 w/enhanced validation) | |
| Datasheet | Anti FASN pAb (ATL-HPA006461 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FASN pAb (ATL-HPA006461 w/enhanced validation) |
| Citations for Anti FASN pAb (ATL-HPA006461 w/enhanced validation) – 2 Found |
| Ramdhave, Anup S; Ojha, Shreesh; Nandave, Mukesh. Energy intake correlates with the levels of fatty acid synthase and insulin-like growth factor-1 in male and female C57BL/6 mice. American Journal Of Translational Research. 9(3):830-844. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |