Anti FASLG pAb (ATL-HPA054959)

Atlas Antibodies

Catalog No.:
ATL-HPA054959-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: Fas ligand (TNF superfamily, member 6)
Gene Name: FASLG
Alternative Gene Name: APT1LG1, CD178, FasL, TNFSF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000817: 76%, ENSRNOG00000002978: 71%
Entrez Gene ID: 356
Uniprot ID: P48023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
Gene Sequence HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV
Gene ID - Mouse ENSMUSG00000000817
Gene ID - Rat ENSRNOG00000002978
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FASLG pAb (ATL-HPA054959)
Datasheet Anti FASLG pAb (ATL-HPA054959) Datasheet (External Link)
Vendor Page Anti FASLG pAb (ATL-HPA054959) at Atlas Antibodies

Documents & Links for Anti FASLG pAb (ATL-HPA054959)
Datasheet Anti FASLG pAb (ATL-HPA054959) Datasheet (External Link)
Vendor Page Anti FASLG pAb (ATL-HPA054959)
Citations for Anti FASLG pAb (ATL-HPA054959) – 1 Found
Ali, Abir Salwa; Perren, Aurel; Lindskog, Cecilia; Welin, Staffan; Sorbye, Halfdan; Grönberg, Malin; Janson, Eva Tiensuu. Candidate protein biomarkers in pancreatic neuroendocrine neoplasms grade 3. Scientific Reports. 2020;10(1):10639.  PubMed