Anti FASLG pAb (ATL-HPA054959)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054959-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: FASLG
Alternative Gene Name: APT1LG1, CD178, FasL, TNFSF6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000817: 76%, ENSRNOG00000002978: 71%
Entrez Gene ID: 356
Uniprot ID: P48023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV |
| Gene Sequence | HTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFV |
| Gene ID - Mouse | ENSMUSG00000000817 |
| Gene ID - Rat | ENSRNOG00000002978 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FASLG pAb (ATL-HPA054959) | |
| Datasheet | Anti FASLG pAb (ATL-HPA054959) Datasheet (External Link) |
| Vendor Page | Anti FASLG pAb (ATL-HPA054959) at Atlas Antibodies |
| Documents & Links for Anti FASLG pAb (ATL-HPA054959) | |
| Datasheet | Anti FASLG pAb (ATL-HPA054959) Datasheet (External Link) |
| Vendor Page | Anti FASLG pAb (ATL-HPA054959) |
| Citations for Anti FASLG pAb (ATL-HPA054959) – 1 Found |
| Ali, Abir Salwa; Perren, Aurel; Lindskog, Cecilia; Welin, Staffan; Sorbye, Halfdan; Grönberg, Malin; Janson, Eva Tiensuu. Candidate protein biomarkers in pancreatic neuroendocrine neoplasms grade 3. Scientific Reports. 2020;10(1):10639. PubMed |