Anti FARP2 pAb (ATL-HPA031226)

Atlas Antibodies

SKU:
ATL-HPA031226-25
  • Immunohistochemical staining of human liver shows distinct cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: FERM, RhoGEF and pleckstrin domain protein 2
Gene Name: FARP2
Alternative Gene Name: FIR, FRG, KIAA0793, PLEKHC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034066: 78%, ENSRNOG00000018051: 79%
Entrez Gene ID: 9855
Uniprot ID: O94887
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNL
Gene Sequence EIEGTYRVLQTAGMRLGAQTPVGVSTLEPGQTLLPRMQEKHLHLRVKLLDNTMEIFDIEPKCDGQVLLTQVWKRLNL
Gene ID - Mouse ENSMUSG00000034066
Gene ID - Rat ENSRNOG00000018051
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FARP2 pAb (ATL-HPA031226)
Datasheet Anti FARP2 pAb (ATL-HPA031226) Datasheet (External Link)
Vendor Page Anti FARP2 pAb (ATL-HPA031226) at Atlas Antibodies

Documents & Links for Anti FARP2 pAb (ATL-HPA031226)
Datasheet Anti FARP2 pAb (ATL-HPA031226) Datasheet (External Link)
Vendor Page Anti FARP2 pAb (ATL-HPA031226)