Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA038413-100
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FANK1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407972).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: fibronectin type III and ankyrin repeat domains 1
Gene Name: FANK1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053111: 88%, ENSRNOG00000018327: 87%
Entrez Gene ID: 92565
Uniprot ID: Q8TC84
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKG
Gene Sequence GGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKG
Gene ID - Mouse ENSMUSG00000053111
Gene ID - Rat ENSRNOG00000018327
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation)
Datasheet Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation)
Datasheet Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FANK1 pAb (ATL-HPA038413 w/enhanced validation)