Anti FANCF pAb (ATL-HPA008899)

Atlas Antibodies

Catalog No.:
ATL-HPA008899-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia complementation group F
Gene Name: FANCF
Alternative Gene Name: FAF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092118: 58%, ENSRNOG00000023968: 62%
Entrez Gene ID: 2188
Uniprot ID: Q9NPI8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR
Gene Sequence GEGSQVLVHWLLGNSEVFAAFCRALPAGLLTLVTSRHPALSPVYLGLLTDWGQRLHYDLQKGIWVGTESQDVPWEELHNRFQSLCQAPPPLKDKVLTALETCKAQDGDFEVPGLSIWTDLLLALRSGAFR
Gene ID - Mouse ENSMUSG00000092118
Gene ID - Rat ENSRNOG00000023968
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FANCF pAb (ATL-HPA008899)
Datasheet Anti FANCF pAb (ATL-HPA008899) Datasheet (External Link)
Vendor Page Anti FANCF pAb (ATL-HPA008899) at Atlas Antibodies

Documents & Links for Anti FANCF pAb (ATL-HPA008899)
Datasheet Anti FANCF pAb (ATL-HPA008899) Datasheet (External Link)
Vendor Page Anti FANCF pAb (ATL-HPA008899)