Anti FANCD2OS pAb (ATL-HPA076166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076166-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FANCD2OS
Alternative Gene Name: C3orf24, MGC40179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033963: 85%, ENSRNOG00000010177: 88%
Entrez Gene ID: 115795
Uniprot ID: Q96PS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK |
| Gene Sequence | WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK |
| Gene ID - Mouse | ENSMUSG00000033963 |
| Gene ID - Rat | ENSRNOG00000010177 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166) | |
| Datasheet | Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link) |
| Vendor Page | Anti FANCD2OS pAb (ATL-HPA076166) at Atlas Antibodies |
| Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166) | |
| Datasheet | Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link) |
| Vendor Page | Anti FANCD2OS pAb (ATL-HPA076166) |