Anti FANCD2OS pAb (ATL-HPA076166)
Atlas Antibodies
- Catalog No.:
- ATL-HPA076166-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: FANCD2OS
Alternative Gene Name: C3orf24, MGC40179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033963: 85%, ENSRNOG00000010177: 88%
Entrez Gene ID: 115795
Uniprot ID: Q96PS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK |
Gene Sequence | WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK |
Gene ID - Mouse | ENSMUSG00000033963 |
Gene ID - Rat | ENSRNOG00000010177 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166) | |
Datasheet | Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link) |
Vendor Page | Anti FANCD2OS pAb (ATL-HPA076166) at Atlas Antibodies |
Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166) | |
Datasheet | Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link) |
Vendor Page | Anti FANCD2OS pAb (ATL-HPA076166) |