Anti FANCD2OS pAb (ATL-HPA076166)

Atlas Antibodies

Catalog No.:
ATL-HPA076166-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: FANCD2 opposite strand
Gene Name: FANCD2OS
Alternative Gene Name: C3orf24, MGC40179
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033963: 85%, ENSRNOG00000010177: 88%
Entrez Gene ID: 115795
Uniprot ID: Q96PS1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
Gene Sequence WTPLDESFQWLRHTTPTPSSKHPFKASPCFPHTPSDLEVQLCFQEVTLVLDSPFLESGVSPKLPCHTSELRTMNNKGLVRK
Gene ID - Mouse ENSMUSG00000033963
Gene ID - Rat ENSRNOG00000010177
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166)
Datasheet Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link)
Vendor Page Anti FANCD2OS pAb (ATL-HPA076166) at Atlas Antibodies

Documents & Links for Anti FANCD2OS pAb (ATL-HPA076166)
Datasheet Anti FANCD2OS pAb (ATL-HPA076166) Datasheet (External Link)
Vendor Page Anti FANCD2OS pAb (ATL-HPA076166)