Anti FANCD2 pAb (ATL-HPA063742)

Atlas Antibodies

SKU:
ATL-HPA063742-25
  • Immunofluorescent staining of human cell line SiHa shows localization to nucleus, nuclear bodies & cytosol.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia, complementation group D2
Gene Name: FANCD2
Alternative Gene Name: FA-D2, FACD, FAD, FANCD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034023: 72%, ENSRNOG00000061085: 76%
Entrez Gene ID: 2177
Uniprot ID: Q9BXW9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
Gene Sequence RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
Gene ID - Mouse ENSMUSG00000034023
Gene ID - Rat ENSRNOG00000061085
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FANCD2 pAb (ATL-HPA063742)
Datasheet Anti FANCD2 pAb (ATL-HPA063742) Datasheet (External Link)
Vendor Page Anti FANCD2 pAb (ATL-HPA063742) at Atlas Antibodies

Documents & Links for Anti FANCD2 pAb (ATL-HPA063742)
Datasheet Anti FANCD2 pAb (ATL-HPA063742) Datasheet (External Link)
Vendor Page Anti FANCD2 pAb (ATL-HPA063742)