Anti FANCC pAb (ATL-HPA030771)

Atlas Antibodies

SKU:
ATL-HPA030771-100
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia, complementation group C
Gene Name: FANCC
Alternative Gene Name: FA3, FAC, FACC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021461: 74%, ENSRNOG00000016889: 73%
Entrez Gene ID: 2176
Uniprot ID: Q00597
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAV
Gene Sequence NSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAV
Gene ID - Mouse ENSMUSG00000021461
Gene ID - Rat ENSRNOG00000016889
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FANCC pAb (ATL-HPA030771)
Datasheet Anti FANCC pAb (ATL-HPA030771) Datasheet (External Link)
Vendor Page Anti FANCC pAb (ATL-HPA030771) at Atlas Antibodies

Documents & Links for Anti FANCC pAb (ATL-HPA030771)
Datasheet Anti FANCC pAb (ATL-HPA030771) Datasheet (External Link)
Vendor Page Anti FANCC pAb (ATL-HPA030771)