Anti FANCA pAb (ATL-HPA063236)

Atlas Antibodies

SKU: ATL-HPA063236-25

• 

Protein Description: Fanconi anemia, complementation group A
Gene Name: FANCA
Alternative Gene Name: FA-H, FAA, FACA, FAH, FANCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032815: 63%, ENSRNOG00000016706: 60%
Entrez Gene ID: 2175
Uniprot ID: O15360
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
• Gene Sequence: LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
• Gene ID - Mouse: ENSMUSG00000032815
• Gene ID - Rat: ENSRNOG00000016706
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.