Anti FANCA pAb (ATL-HPA063236)

Atlas Antibodies

SKU:
ATL-HPA063236-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleus.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Fanconi anemia, complementation group A
Gene Name: FANCA
Alternative Gene Name: FA-H, FAA, FACA, FAH, FANCH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032815: 63%, ENSRNOG00000016706: 60%
Entrez Gene ID: 2175
Uniprot ID: O15360
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
Gene Sequence LQALTSGWSVAASLQRQRELLMYKRILLRLPSSVLCGSSFQAEQPITARCEQFFHLVNSEMRNFCSHGGALTQDITAHFF
Gene ID - Mouse ENSMUSG00000032815
Gene ID - Rat ENSRNOG00000016706
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FANCA pAb (ATL-HPA063236)
Datasheet Anti FANCA pAb (ATL-HPA063236) Datasheet (External Link)
Vendor Page Anti FANCA pAb (ATL-HPA063236) at Atlas Antibodies

Documents & Links for Anti FANCA pAb (ATL-HPA063236)
Datasheet Anti FANCA pAb (ATL-HPA063236) Datasheet (External Link)
Vendor Page Anti FANCA pAb (ATL-HPA063236)