Anti FAM98C pAb (ATL-HPA041730 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041730-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic and membranous positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM98C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406389).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 98, member C
Gene Name: FAM98C
Alternative Gene Name: FLJ44669
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030590: 83%, ENSRNOG00000024036: 79%
Entrez Gene ID: 147965
Uniprot ID: Q17RN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLLSCSLDAPRWEALESLSQSLRDQYRCRRCLLLKRLDLTTSAFHWSDRAEAQGEAMRAVLIPIREVLTPESDISIAHVLAARADLSCLVPA
Gene Sequence PLLSCSLDAPRWEALESLSQSLRDQYRCRRCLLLKRLDLTTSAFHWSDRAEAQGEAMRAVLIPIREVLTPESDISIAHVLAARADLSCLVPA
Gene ID - Mouse ENSMUSG00000030590
Gene ID - Rat ENSRNOG00000024036
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM98C pAb (ATL-HPA041730 w/enhanced validation)
Datasheet Anti FAM98C pAb (ATL-HPA041730 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM98C pAb (ATL-HPA041730 w/enhanced validation)