Anti FAM98C pAb (ATL-HPA040930)

Atlas Antibodies

SKU: ATL-HPA040930-25

• 
• 
• 

Protein Description: family with sequence similarity 98, member C
Gene Name: FAM98C
Alternative Gene Name: FLJ44669
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030590: 70%, ENSRNOG00000024036: 70%
Entrez Gene ID: 147965
Uniprot ID: Q17RN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA
• Gene Sequence: EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA
• Gene ID - Mouse: ENSMUSG00000030590
• Gene ID - Rat: ENSRNOG00000024036
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.