Anti FAM98C pAb (ATL-HPA040930)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040930-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM98C
Alternative Gene Name: FLJ44669
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030590: 70%, ENSRNOG00000024036: 70%
Entrez Gene ID: 147965
Uniprot ID: Q17RN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA |
Gene Sequence | EPGAGLRLLRFLCSELQATRLLCLRSLLDPSPRPPLGEGVVEGAGMVQELDLTLQALGLPRPAPGTPASQLLQELHA |
Gene ID - Mouse | ENSMUSG00000030590 |
Gene ID - Rat | ENSRNOG00000024036 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti FAM98C pAb (ATL-HPA040930) | |
Datasheet | Anti FAM98C pAb (ATL-HPA040930) Datasheet (External Link) |
Vendor Page | Anti FAM98C pAb (ATL-HPA040930) at Atlas Antibodies |
Documents & Links for Anti FAM98C pAb (ATL-HPA040930) | |
Datasheet | Anti FAM98C pAb (ATL-HPA040930) Datasheet (External Link) |
Vendor Page | Anti FAM98C pAb (ATL-HPA040930) |