Anti FAM98B pAb (ATL-HPA008502 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA008502-25
  • Immunohistochemical staining of human cerebral cortex, gastrointestinal, skeletal muscle and testis using Anti-FAM98B antibody HPA008502 (A) shows similar protein distribution across tissues to independent antibody HPA008320 (B).
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & vesicles.
  • Western blot analysis using Anti-FAM98B antibody HPA008502 (A) shows similar pattern to independent antibody HPA008320 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 98, member B
Gene Name: FAM98B
Alternative Gene Name: FLJ38426
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027349: 92%, ENSRNOG00000005366: 90%
Entrez Gene ID: 283742
Uniprot ID: Q52LJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQN
Gene Sequence GPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFLSTELQASQILQN
Gene ID - Mouse ENSMUSG00000027349
Gene ID - Rat ENSRNOG00000005366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM98B pAb (ATL-HPA008502 w/enhanced validation)
Datasheet Anti FAM98B pAb (ATL-HPA008502 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM98B pAb (ATL-HPA008502 w/enhanced validation)