Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA008320-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 98, member B
Gene Name: FAM98B
Alternative Gene Name: FLJ38426
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027349: 90%, ENSRNOG00000005366: 69%
Entrez Gene ID: 283742
Uniprot ID: Q52LJ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
Gene Sequence STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
Gene ID - Mouse ENSMUSG00000027349
Gene ID - Rat ENSRNOG00000005366
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation)
Datasheet Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation)
Datasheet Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation)
Citations for Anti FAM98B pAb (ATL-HPA008320 w/enhanced validation) – 3 Found
Jurkin, Jennifer; Henkel, Theresa; Nielsen, Anne Færch; Minnich, Martina; Popow, Johannes; Kaufmann, Therese; Heindl, Katrin; Hoffmann, Thomas; Busslinger, Meinrad; Martinez, Javier. The mammalian tRNA ligase complex mediates splicing of XBP1 mRNA and controls antibody secretion in plasma cells. The Embo Journal. 2014;33(24):2922-36.  PubMed
Pérez-González, Alicia; Pazo, Alejandra; Navajas, Rosana; Ciordia, Sergio; Rodriguez-Frandsen, Ariel; Nieto, Amelia. hCLE/C14orf166 associates with DDX1-HSPC117-FAM98B in a novel transcription-dependent shuttling RNA-transporting complex. Plos One. 9(3):e90957.  PubMed
Popow, Johannes; Jurkin, Jennifer; Schleiffer, Alexander; Martinez, Javier. Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors. Nature. 2014;511(7507):104-7.  PubMed