Anti FAM84B pAb (ATL-HPA050782)

Atlas Antibodies

Catalog No.:
ATL-HPA050782-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 84, member B
Gene Name: FAM84B
Alternative Gene Name: BCMP101, NSE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072568: 98%, ENSRNOG00000004744: 98%
Entrez Gene ID: 157638
Uniprot ID: Q96KN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQ
Gene Sequence EVECSVFYRDECIYQKSFAPGSAALSTYTPENLLNKCKPGDLVEFVSQAQYPHWAVYVGNFQVVHLHRLEVINSFLTDASQ
Gene ID - Mouse ENSMUSG00000072568
Gene ID - Rat ENSRNOG00000004744
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM84B pAb (ATL-HPA050782)
Datasheet Anti FAM84B pAb (ATL-HPA050782) Datasheet (External Link)
Vendor Page Anti FAM84B pAb (ATL-HPA050782) at Atlas Antibodies

Documents & Links for Anti FAM84B pAb (ATL-HPA050782)
Datasheet Anti FAM84B pAb (ATL-HPA050782) Datasheet (External Link)
Vendor Page Anti FAM84B pAb (ATL-HPA050782)