Anti FAM84A pAb (ATL-HPA047703)

Atlas Antibodies

SKU:
ATL-HPA047703-100
  • Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in exocrine glandular cells.
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 84, member A
Gene Name: FAM84A
Alternative Gene Name: FLJ35392, NSE1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020607: 95%, ENSRNOG00000004084: 95%
Entrez Gene ID: 151354
Uniprot ID: Q96KN4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGP
Gene Sequence PSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGP
Gene ID - Mouse ENSMUSG00000020607
Gene ID - Rat ENSRNOG00000004084
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM84A pAb (ATL-HPA047703)
Datasheet Anti FAM84A pAb (ATL-HPA047703) Datasheet (External Link)
Vendor Page Anti FAM84A pAb (ATL-HPA047703) at Atlas Antibodies

Documents & Links for Anti FAM84A pAb (ATL-HPA047703)
Datasheet Anti FAM84A pAb (ATL-HPA047703) Datasheet (External Link)
Vendor Page Anti FAM84A pAb (ATL-HPA047703)