Anti FAM83H pAb (ATL-HPA024505 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA024505-100
  • Immunohistochemistry analysis in human skin and skeletal muscle tissues using HPA024505 antibody. Corresponding FAM83H RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line MCF-7.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 83, member H
Gene Name: FAM83H
Alternative Gene Name: FLJ46072
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046761: 89%, ENSRNOG00000030264: 89%
Entrez Gene ID: 286077
Uniprot ID: Q6ZRV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Gene Sequence SDKDKCSAIFRSDSLGTQGRLSRTLPASAEERDRLLRRMESMRKEKRVYSRFEVFCKKEEASSPGAGEGPAEEGTRDSKVGKFVPKILGTF
Gene ID - Mouse ENSMUSG00000046761
Gene ID - Rat ENSRNOG00000030264
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM83H pAb (ATL-HPA024505 w/enhanced validation)
Datasheet Anti FAM83H pAb (ATL-HPA024505 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM83H pAb (ATL-HPA024505 w/enhanced validation)