Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA023940-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 83, member G
Gene Name: FAM83G
Alternative Gene Name: FLJ41564, PAWS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042377: 55%, ENSRNOG00000027924: 56%
Entrez Gene ID: 644815
Uniprot ID: A6ND36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPRYRSAADSVQSSTRNAGPAMAGPHHWQAKGGQ
Gene Sequence AQRSTDKEAQGQQFHHHRVPASGTRDKDGFPGPPRYRSAADSVQSSTRNAGPAMAGPHHWQAKGGQ
Gene ID - Mouse ENSMUSG00000042377
Gene ID - Rat ENSRNOG00000027924
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation)
Datasheet Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation)
Datasheet Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation)
Citations for Anti FAM83G pAb (ATL-HPA023940 w/enhanced validation) – 1 Found
Cummins, Timothy D; Wu, Kevin Z L; Bozatzi, Polyxeni; Dingwell, Kevin S; Macartney, Thomas J; Wood, Nicola T; Varghese, Joby; Gourlay, Robert; Campbell, David G; Prescott, Alan; Griffis, Eric; Smith, James C; Sapkota, Gopal P. PAWS1 controls cytoskeletal dynamics and cell migration through association with the SH3 adaptor CD2AP. Journal Of Cell Science. 2018;131(1)  PubMed