Anti FAM83F pAb (ATL-HPA064657)

Atlas Antibodies

Catalog No.:
ATL-HPA064657-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 83, member F
Gene Name: FAM83F
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022408: 82%, ENSRNOG00000018330: 85%
Entrez Gene ID: 113828
Uniprot ID: Q8NEG4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN
Gene Sequence SYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDLYRQLSLAGRVGLHYSSTVARKLIN
Gene ID - Mouse ENSMUSG00000022408
Gene ID - Rat ENSRNOG00000018330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM83F pAb (ATL-HPA064657)
Datasheet Anti FAM83F pAb (ATL-HPA064657) Datasheet (External Link)
Vendor Page Anti FAM83F pAb (ATL-HPA064657) at Atlas Antibodies

Documents & Links for Anti FAM83F pAb (ATL-HPA064657)
Datasheet Anti FAM83F pAb (ATL-HPA064657) Datasheet (External Link)
Vendor Page Anti FAM83F pAb (ATL-HPA064657)