Anti FAM83D pAb (ATL-HPA060854)

Atlas Antibodies

Catalog No.:
ATL-HPA060854-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 83 member D
Gene Name: FAM83D
Alternative Gene Name: C20orf129, CHICA, dJ616B8.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027654: 61%, ENSRNOG00000015794: 64%
Entrez Gene ID: 81610
Uniprot ID: Q9H4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFS
Gene Sequence ASSTGSPASIRTTDFHNPGYPKYLGTPHLELYLSDSLRNLNKERQFHFAGIRSRLNHMLAMLSRRTLFTENHLGLHSGNFS
Gene ID - Mouse ENSMUSG00000027654
Gene ID - Rat ENSRNOG00000015794
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM83D pAb (ATL-HPA060854)
Datasheet Anti FAM83D pAb (ATL-HPA060854) Datasheet (External Link)
Vendor Page Anti FAM83D pAb (ATL-HPA060854) at Atlas Antibodies

Documents & Links for Anti FAM83D pAb (ATL-HPA060854)
Datasheet Anti FAM83D pAb (ATL-HPA060854) Datasheet (External Link)
Vendor Page Anti FAM83D pAb (ATL-HPA060854)