Anti FAM81A pAb (ATL-HPA065797)

Atlas Antibodies

SKU:
ATL-HPA065797-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 81, member A
Gene Name: FAM81A
Alternative Gene Name: MGC26690
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032224: 81%, ENSRNOG00000057501: 83%
Entrez Gene ID: 145773
Uniprot ID: Q8TBF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ
Gene Sequence QLSLIVKENSGASERDMEKKLSQMSARLDKIEEGQKKTFDGQRTRQEEEKMHGRITKLELQMNQNIKEMKAEVNAGFTAVYESIGSLRQVLEAKMKLDRDQLQKQIQ
Gene ID - Mouse ENSMUSG00000032224
Gene ID - Rat ENSRNOG00000057501
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM81A pAb (ATL-HPA065797)
Datasheet Anti FAM81A pAb (ATL-HPA065797) Datasheet (External Link)
Vendor Page Anti FAM81A pAb (ATL-HPA065797) at Atlas Antibodies

Documents & Links for Anti FAM81A pAb (ATL-HPA065797)
Datasheet Anti FAM81A pAb (ATL-HPA065797) Datasheet (External Link)
Vendor Page Anti FAM81A pAb (ATL-HPA065797)