Anti FAM78B pAb (ATL-HPA073246)

Atlas Antibodies

SKU:
ATL-HPA073246-25
  • Immunofluorescent staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 78, member B
Gene Name: FAM78B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060568: 100%, ENSRNOG00000051941: 83%
Entrez Gene ID: 149297
Uniprot ID: Q5VT40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR
Gene Sequence IRRENIVVYDVCATIDQCPTRIEETSPIVLRYKTPYFKASAR
Gene ID - Mouse ENSMUSG00000060568
Gene ID - Rat ENSRNOG00000051941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM78B pAb (ATL-HPA073246)
Datasheet Anti FAM78B pAb (ATL-HPA073246) Datasheet (External Link)
Vendor Page Anti FAM78B pAb (ATL-HPA073246) at Atlas Antibodies

Documents & Links for Anti FAM78B pAb (ATL-HPA073246)
Datasheet Anti FAM78B pAb (ATL-HPA073246) Datasheet (External Link)
Vendor Page Anti FAM78B pAb (ATL-HPA073246)