Anti FAM78A pAb (ATL-HPA023914)

Atlas Antibodies

SKU:
ATL-HPA023914-25
  • Immunohistochemical staining of human corpus, uterine shows strong cytoplasmic positivity(granular pattern) in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 78, member A
Gene Name: FAM78A
Alternative Gene Name: C9orf59, FLJ00024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050592: 94%, ENSRNOG00000023352: 94%
Entrez Gene ID: 286336
Uniprot ID: Q5JUQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTP
Gene Sequence FCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTP
Gene ID - Mouse ENSMUSG00000050592
Gene ID - Rat ENSRNOG00000023352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM78A pAb (ATL-HPA023914)
Datasheet Anti FAM78A pAb (ATL-HPA023914) Datasheet (External Link)
Vendor Page Anti FAM78A pAb (ATL-HPA023914) at Atlas Antibodies

Documents & Links for Anti FAM78A pAb (ATL-HPA023914)
Datasheet Anti FAM78A pAb (ATL-HPA023914) Datasheet (External Link)
Vendor Page Anti FAM78A pAb (ATL-HPA023914)