Anti FAM78A pAb (ATL-HPA023914)

Atlas Antibodies

Catalog No.: ATL-HPA023914-25

Protein Description: family with sequence similarity 78, member A
Gene Name: FAM78A
Alternative Gene Name: C9orf59, FLJ00024
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050592: 94%, ENSRNOG00000023352: 94%
Entrez Gene ID: 286336
Uniprot ID: Q5JUQ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTP
• Gene Sequence: FCDCWPSLEIRALLYAMGCIQSIGGKARVFREGITVIDVKASIDPVPTSIDESSSVVLRYRTP
• Gene ID - Mouse: ENSMUSG00000050592
• Gene ID - Rat: ENSRNOG00000023352
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.