Anti FAM76B pAb (ATL-HPA036608)

Atlas Antibodies

Catalog No.:
ATL-HPA036608-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 76, member B
Gene Name: FAM76B
Alternative Gene Name: MGC33371
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037808: 94%, ENSRNOG00000024863: 61%
Entrez Gene ID: 143684
Uniprot ID: Q5HYJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEE
Gene Sequence HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEE
Gene ID - Mouse ENSMUSG00000037808
Gene ID - Rat ENSRNOG00000024863
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM76B pAb (ATL-HPA036608)
Datasheet Anti FAM76B pAb (ATL-HPA036608) Datasheet (External Link)
Vendor Page Anti FAM76B pAb (ATL-HPA036608) at Atlas Antibodies

Documents & Links for Anti FAM76B pAb (ATL-HPA036608)
Datasheet Anti FAM76B pAb (ATL-HPA036608) Datasheet (External Link)
Vendor Page Anti FAM76B pAb (ATL-HPA036608)