Anti FAM76B pAb (ATL-HPA036608)

Atlas Antibodies

Catalog No.: ATL-HPA036608-25

Protein Description: family with sequence similarity 76, member B
Gene Name: FAM76B
Alternative Gene Name: MGC33371
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037808: 94%, ENSRNOG00000024863: 61%
Entrez Gene ID: 143684
Uniprot ID: Q5HYJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEE
• Gene Sequence: HHRHSSSHHKISNLSPEEEQGLWKQSHKSSATIQNETPKKKPKLESKPSNGDSSSINQSADSGGTDNFVLISQLKEE
• Gene ID - Mouse: ENSMUSG00000037808
• Gene ID - Rat: ENSRNOG00000024863
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.