Anti FAM76A pAb (ATL-HPA077897)

Atlas Antibodies

Catalog No.:
ATL-HPA077897-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 76, member A
Gene Name: FAM76A
Alternative Gene Name: MGC34648
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028878: 67%, ENSRNOG00000011254: 67%
Entrez Gene ID: 199870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QMRAKMNQMEKTHKEVTEQLQVTDSAYFMC
Gene Sequence QMRAKMNQMEKTHKEVTEQLQVTDSAYFMC
Gene ID - Mouse ENSMUSG00000028878
Gene ID - Rat ENSRNOG00000011254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM76A pAb (ATL-HPA077897)
Datasheet Anti FAM76A pAb (ATL-HPA077897) Datasheet (External Link)
Vendor Page Anti FAM76A pAb (ATL-HPA077897) at Atlas Antibodies

Documents & Links for Anti FAM76A pAb (ATL-HPA077897)
Datasheet Anti FAM76A pAb (ATL-HPA077897) Datasheet (External Link)
Vendor Page Anti FAM76A pAb (ATL-HPA077897)