Anti FAM76A pAb (ATL-HPA077897)

Atlas Antibodies

Catalog No.: ATL-HPA077897-25

Protein Description: family with sequence similarity 76, member A
Gene Name: FAM76A
Alternative Gene Name: MGC34648
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028878: 67%, ENSRNOG00000011254: 67%
Entrez Gene ID: 199870
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QMRAKMNQMEKTHKEVTEQLQVTDSAYFMC
• Gene Sequence: QMRAKMNQMEKTHKEVTEQLQVTDSAYFMC
• Gene ID - Mouse: ENSMUSG00000028878
• Gene ID - Rat: ENSRNOG00000011254
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.