Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA040771-25

• 

Protein Description: family with sequence similarity 71, member B
Gene Name: FAM71B
Alternative Gene Name: MGC26988
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020401: 42%, ENSRNOG00000021425: 47%
Entrez Gene ID: 153745
Uniprot ID: Q8TC56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QELGKNQSASSTGALQKKASKISSFLRSLRATPGSKTRVTSHDREVDIVAKMVEKQNIEAKVEKAQGGQELEMISGTMTSEKTEMIVFET
• Gene Sequence: QELGKNQSASSTGALQKKASKISSFLRSLRATPGSKTRVTSHDREVDIVAKMVEKQNIEAKVEKAQGGQELEMISGTMTSEKTEMIVFET
• Gene ID - Mouse: ENSMUSG00000020401
• Gene ID - Rat: ENSRNOG00000021425
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.