Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040771-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 71, member B
Gene Name: FAM71B
Alternative Gene Name: MGC26988
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020401: 42%, ENSRNOG00000021425: 47%
Entrez Gene ID: 153745
Uniprot ID: Q8TC56
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QELGKNQSASSTGALQKKASKISSFLRSLRATPGSKTRVTSHDREVDIVAKMVEKQNIEAKVEKAQGGQELEMISGTMTSEKTEMIVFET
Gene Sequence QELGKNQSASSTGALQKKASKISSFLRSLRATPGSKTRVTSHDREVDIVAKMVEKQNIEAKVEKAQGGQELEMISGTMTSEKTEMIVFET
Gene ID - Mouse ENSMUSG00000020401
Gene ID - Rat ENSRNOG00000021425
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation)
Datasheet Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation)
Datasheet Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM71B pAb (ATL-HPA040771 w/enhanced validation)