Anti FAM64A pAb (ATL-HPA043783)

Atlas Antibodies

SKU: ATL-HPA043783-25

• 

Protein Description: family with sequence similarity 64, member A
Gene Name: FAM64A
Alternative Gene Name: CATS, FLJ10156, FLJ10491
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020808: 68%, ENSRNOG00000008040: 65%
Entrez Gene ID: 54478
Uniprot ID: Q9BSJ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQ
• Gene Sequence: VETQVKARRRKRGAQKGSGSPTHSLSQKSTRLSGAAPAHSAADPWEKEHHRLSVRMGSHAHPLRRSRREAAFRSPYSSTEPLCSPSESDSDLEPVGAGIQHLQ
• Gene ID - Mouse: ENSMUSG00000020808
• Gene ID - Rat: ENSRNOG00000008040
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM64A pAb (ATL-HPA043783) – 1 Found

Wang, Linbang; Liu, Wei; Liu, Jingkun; Wang, Yuanyuan; Tai, Jiaojiao; Yin, Xuedong; Tan, Jinxiang. Identification of Immune-Related Therapeutically Relevant Biomarkers in Breast Cancer and Breast Cancer Stem Cells by Transcriptome-Wide Analysis: A Clinical Prospective Study. Frontiers In Oncology. 10( 33718103):554138.