Anti FAM53C pAb (ATL-HPA042796 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA042796-25
  • Immunohistochemical staining of human testis shows cytoplasmic and nuclear positivity in cells in seminiferous ducts and Leydig cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and FAM53C over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY413860).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 53, member C
Gene Name: FAM53C
Alternative Gene Name: C5orf6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034300: 94%, ENSRNOG00000020261: 96%
Entrez Gene ID: 51307
Uniprot ID: Q9NYF3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSSQVLSESEE
Gene Sequence WRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSSQVLSESEE
Gene ID - Mouse ENSMUSG00000034300
Gene ID - Rat ENSRNOG00000020261
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti FAM53C pAb (ATL-HPA042796 w/enhanced validation)
Datasheet Anti FAM53C pAb (ATL-HPA042796 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti FAM53C pAb (ATL-HPA042796 w/enhanced validation)