Anti FAM53B pAb (ATL-HPA037751)

Atlas Antibodies

SKU:
ATL-HPA037751-25
  • Immunohistochemical staining of human gall bladder shows distinct cytoplasmic, membranous and nuclear positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 53, member B
Gene Name: FAM53B
Alternative Gene Name: bA12J10.2, KIAA0140
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030956: 85%, ENSRNOG00000061348: 85%
Entrez Gene ID: 9679
Uniprot ID: Q14153
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQIDQPSTSIWECLPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPS
Gene Sequence ADSIACGTFSRELHTPKKMSQGPTLFSCGIMENDRWRDLDRKCPLQIDQPSTSIWECLPEKDSSLWHREAVTACAVTSLIKDLSISDHNGNPS
Gene ID - Mouse ENSMUSG00000030956
Gene ID - Rat ENSRNOG00000061348
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM53B pAb (ATL-HPA037751)
Datasheet Anti FAM53B pAb (ATL-HPA037751) Datasheet (External Link)
Vendor Page Anti FAM53B pAb (ATL-HPA037751) at Atlas Antibodies

Documents & Links for Anti FAM53B pAb (ATL-HPA037751)
Datasheet Anti FAM53B pAb (ATL-HPA037751) Datasheet (External Link)
Vendor Page Anti FAM53B pAb (ATL-HPA037751)