Anti FAM50A pAb (ATL-HPA003585)

Atlas Antibodies

SKU:
ATL-HPA003585-25
  • Immunohistochemical staining of human skeletal muscle shows strong nuclear positivity in myocytes.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
  • Western blot analysis in human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 50, member A
Gene Name: FAM50A
Alternative Gene Name: 9F, DXS9928E, HXC-26, XAP5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001962: 95%, ENSRNOG00000058439: 96%
Entrez Gene ID: 9130
Uniprot ID: Q14320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Gene Sequence VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
Gene ID - Mouse ENSMUSG00000001962
Gene ID - Rat ENSRNOG00000058439
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti FAM50A pAb (ATL-HPA003585)
Datasheet Anti FAM50A pAb (ATL-HPA003585) Datasheet (External Link)
Vendor Page Anti FAM50A pAb (ATL-HPA003585) at Atlas Antibodies

Documents & Links for Anti FAM50A pAb (ATL-HPA003585)
Datasheet Anti FAM50A pAb (ATL-HPA003585) Datasheet (External Link)
Vendor Page Anti FAM50A pAb (ATL-HPA003585)



Citations for Anti FAM50A pAb (ATL-HPA003585) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed