Anti FAM49B pAb (ATL-HPA009076)
Atlas Antibodies
- Catalog No.:
- ATL-HPA009076-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: FAM49B
Alternative Gene Name: BM-009
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022378: 100%, ENSRNOG00000061246: 100%
Entrez Gene ID: 51571
Uniprot ID: Q9NUQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAE |
| Gene Sequence | GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAE |
| Gene ID - Mouse | ENSMUSG00000022378 |
| Gene ID - Rat | ENSRNOG00000061246 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM49B pAb (ATL-HPA009076) | |
| Datasheet | Anti FAM49B pAb (ATL-HPA009076) Datasheet (External Link) |
| Vendor Page | Anti FAM49B pAb (ATL-HPA009076) at Atlas Antibodies |
| Documents & Links for Anti FAM49B pAb (ATL-HPA009076) | |
| Datasheet | Anti FAM49B pAb (ATL-HPA009076) Datasheet (External Link) |
| Vendor Page | Anti FAM49B pAb (ATL-HPA009076) |
| Citations for Anti FAM49B pAb (ATL-HPA009076) – 1 Found |
| Le, Anh Hoang; Yelland, Tamas; Paul, Nikki R; Fort, Loic; Nikolaou, Savvas; Ismail, Shehab; Machesky, Laura M. CYRI-A limits invasive migration through macropinosome formation and integrin uptake regulation. The Journal Of Cell Biology. 2021;220(9) PubMed |