Anti FAM49B pAb (ATL-HPA009076)

Atlas Antibodies

SKU: ATL-HPA009076-25

• 
• 
• 

Protein Description: family with sequence similarity 49, member B
Gene Name: FAM49B
Alternative Gene Name: BM-009
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022378: 100%, ENSRNOG00000061246: 100%
Entrez Gene ID: 51571
Uniprot ID: Q9NUQ9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAE
• Gene Sequence: GNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAGHEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQHLEREQALAKQFAE
• Gene ID - Mouse: ENSMUSG00000022378
• Gene ID - Rat: ENSRNOG00000061246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM49B pAb (ATL-HPA009076) – 1 Found

Le, Anh Hoang; Yelland, Tamas; Paul, Nikki R; Fort, Loic; Nikolaou, Savvas; Ismail, Shehab; Machesky, Laura M. CYRI-A limits invasive migration through macropinosome formation and integrin uptake regulation. The Journal Of Cell Biology. 2021;220(9)