Anti FAM49A pAb (ATL-HPA060398)

Atlas Antibodies

Catalog No.:
ATL-HPA060398-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 49, member A
Gene Name: FAM49A
Alternative Gene Name: DKFZP566A1524, FLJ11080
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020589: 98%, ENSRNOG00000052758: 98%
Entrez Gene ID: 81553
Uniprot ID: Q9H0Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPNDIQ
Gene Sequence GEREIWNQISAVLQDSESILADLQAYKGAGPEIRDAIQNPNDIQ
Gene ID - Mouse ENSMUSG00000020589
Gene ID - Rat ENSRNOG00000052758
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM49A pAb (ATL-HPA060398)
Datasheet Anti FAM49A pAb (ATL-HPA060398) Datasheet (External Link)
Vendor Page Anti FAM49A pAb (ATL-HPA060398) at Atlas Antibodies

Documents & Links for Anti FAM49A pAb (ATL-HPA060398)
Datasheet Anti FAM49A pAb (ATL-HPA060398) Datasheet (External Link)
Vendor Page Anti FAM49A pAb (ATL-HPA060398)