Anti FAM46D pAb (ATL-HPA059362)

Atlas Antibodies

Catalog No.:
ATL-HPA059362-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 46, member D
Gene Name: FAM46D
Alternative Gene Name: CT1.26, CT112, MGC26999
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073007: 82%, ENSRNOG00000023637: 85%
Entrez Gene ID: 169966
Uniprot ID: Q8NEK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQV
Gene Sequence PTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQV
Gene ID - Mouse ENSMUSG00000073007
Gene ID - Rat ENSRNOG00000023637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM46D pAb (ATL-HPA059362)
Datasheet Anti FAM46D pAb (ATL-HPA059362) Datasheet (External Link)
Vendor Page Anti FAM46D pAb (ATL-HPA059362) at Atlas Antibodies

Documents & Links for Anti FAM46D pAb (ATL-HPA059362)
Datasheet Anti FAM46D pAb (ATL-HPA059362) Datasheet (External Link)
Vendor Page Anti FAM46D pAb (ATL-HPA059362)