Anti FAM46D pAb (ATL-HPA059362)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059362-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: FAM46D
Alternative Gene Name: CT1.26, CT112, MGC26999
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073007: 82%, ENSRNOG00000023637: 85%
Entrez Gene ID: 169966
Uniprot ID: Q8NEK8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQV |
| Gene Sequence | PTMEVKPKDIIHVVKDQLIGQGIIVKDARLNGSVASYILASHNGISYKDLDVIFGVELPGNEEFQV |
| Gene ID - Mouse | ENSMUSG00000073007 |
| Gene ID - Rat | ENSRNOG00000023637 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM46D pAb (ATL-HPA059362) | |
| Datasheet | Anti FAM46D pAb (ATL-HPA059362) Datasheet (External Link) |
| Vendor Page | Anti FAM46D pAb (ATL-HPA059362) at Atlas Antibodies |
| Documents & Links for Anti FAM46D pAb (ATL-HPA059362) | |
| Datasheet | Anti FAM46D pAb (ATL-HPA059362) Datasheet (External Link) |
| Vendor Page | Anti FAM46D pAb (ATL-HPA059362) |