Anti FAM46C pAb (ATL-HPA054049)

Atlas Antibodies

Catalog No.:
ATL-HPA054049-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 46, member C
Gene Name: FAM46C
Alternative Gene Name: FLJ20202
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044468: 87%, ENSRNOG00000015222: 85%
Entrez Gene ID: 54855
Uniprot ID: Q5VWP2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRG
Gene Sequence MAEESSCTRDCMSFSVLNWDQVSRLHEVLTEVVPIHGRG
Gene ID - Mouse ENSMUSG00000044468
Gene ID - Rat ENSRNOG00000015222
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM46C pAb (ATL-HPA054049)
Datasheet Anti FAM46C pAb (ATL-HPA054049) Datasheet (External Link)
Vendor Page Anti FAM46C pAb (ATL-HPA054049) at Atlas Antibodies

Documents & Links for Anti FAM46C pAb (ATL-HPA054049)
Datasheet Anti FAM46C pAb (ATL-HPA054049) Datasheet (External Link)
Vendor Page Anti FAM46C pAb (ATL-HPA054049)