Anti FAM46A pAb (ATL-HPA067140)

Atlas Antibodies

Catalog No.:
ATL-HPA067140-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 46, member A
Gene Name: FAM46A
Alternative Gene Name: C6orf37, FLJ20037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032265: 87%, ENSRNOG00000010240: 89%
Entrez Gene ID: 55603
Uniprot ID: Q96IP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI
Gene Sequence GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI
Gene ID - Mouse ENSMUSG00000032265
Gene ID - Rat ENSRNOG00000010240
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM46A pAb (ATL-HPA067140)
Datasheet Anti FAM46A pAb (ATL-HPA067140) Datasheet (External Link)
Vendor Page Anti FAM46A pAb (ATL-HPA067140) at Atlas Antibodies

Documents & Links for Anti FAM46A pAb (ATL-HPA067140)
Datasheet Anti FAM46A pAb (ATL-HPA067140) Datasheet (External Link)
Vendor Page Anti FAM46A pAb (ATL-HPA067140)