Anti FAM46A pAb (ATL-HPA067140)

Atlas Antibodies

SKU: ATL-HPA067140-25

• 

Protein Description: family with sequence similarity 46, member A
Gene Name: FAM46A
Alternative Gene Name: C6orf37, FLJ20037
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032265: 87%, ENSRNOG00000010240: 89%
Entrez Gene ID: 55603
Uniprot ID: Q96IP4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI
• Gene Sequence: GYFAMSEDELACSPYIPLGGDFGGGGSFGGHCLDYCESPTAHCNVLNWEQVQRLDGILSETI
• Gene ID - Mouse: ENSMUSG00000032265
• Gene ID - Rat: ENSRNOG00000010240
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.