Anti FAM45A pAb (ATL-HPA041159 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041159-25

• 
• 

Protein Description: family with sequence similarity 45, member A
Gene Name: FAM45A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024993: 90%, ENSRNOG00000010230: 90%
Entrez Gene ID: 404636
Uniprot ID: Q8TCE6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIA
• Gene Sequence: GYVAGFVDLEVSNRPDLYDVFVNLAESEITIAPLAKEAMAMGKLHKEMGQLIVQSAEDPEKSESHVIQDIA
• Gene ID - Mouse: ENSMUSG00000024993
• Gene ID - Rat: ENSRNOG00000010230
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.