Anti FAM3A pAb (ATL-HPA056991)

Atlas Antibodies

Catalog No.:
ATL-HPA056991-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 3, member A
Gene Name: FAM3A
Alternative Gene Name: 2-19, DXS560S, XAP-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031399: 88%, ENSRNOG00000060623: 90%
Entrez Gene ID: 60343
Uniprot ID: P98173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG
Gene Sequence GFPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIG
Gene ID - Mouse ENSMUSG00000031399
Gene ID - Rat ENSRNOG00000060623
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM3A pAb (ATL-HPA056991)
Datasheet Anti FAM3A pAb (ATL-HPA056991) Datasheet (External Link)
Vendor Page Anti FAM3A pAb (ATL-HPA056991) at Atlas Antibodies

Documents & Links for Anti FAM3A pAb (ATL-HPA056991)
Datasheet Anti FAM3A pAb (ATL-HPA056991) Datasheet (External Link)
Vendor Page Anti FAM3A pAb (ATL-HPA056991)
Citations for Anti FAM3A pAb (ATL-HPA056991) – 1 Found
Xu, Wenjing; Liang, Minglu; Zhang, Yanqing; Huang, Kai; Wang, Cheng. Endothelial FAM3A positively regulates post-ischaemic angiogenesis. Ebiomedicine. 2019;43( 31000420):32-42.  PubMed