Anti FAM3A pAb (ATL-HPA035268)

Atlas Antibodies

Catalog No.: ATL-HPA035268-25

Protein Description: family with sequence similarity 3 member A
Gene Name: FAM3A
Alternative Gene Name: 2-19, DXS560S, XAP-7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031399: 90%, ENSRNOG00000060623: 92%
Entrez Gene ID: 60343
Uniprot ID: P98173
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLM
• Gene Sequence: FPRIQQLFTSPESSVTAAPRARKYKCGLPQPCPEEHLAFRVVSGAANVIGPKICLEDKMLM
• Gene ID - Mouse: ENSMUSG00000031399
• Gene ID - Rat: ENSRNOG00000060623
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.