Anti FAM32A pAb (ATL-HPA051712)

Atlas Antibodies

Catalog No.:
ATL-HPA051712-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 32, member A
Gene Name: FAM32A
Alternative Gene Name: DKFZP586O0120
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003039: 98%, ENSRNOG00000039528: 98%
Entrez Gene ID: 26017
Uniprot ID: Q9Y421
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
Gene Sequence RLDKRTPAQAAFEKMQEKRQMERILKKASKTHKQRVEDFNRHLDTLTEHYDIPKVSWTK
Gene ID - Mouse ENSMUSG00000003039
Gene ID - Rat ENSRNOG00000039528
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM32A pAb (ATL-HPA051712)
Datasheet Anti FAM32A pAb (ATL-HPA051712) Datasheet (External Link)
Vendor Page Anti FAM32A pAb (ATL-HPA051712) at Atlas Antibodies

Documents & Links for Anti FAM32A pAb (ATL-HPA051712)
Datasheet Anti FAM32A pAb (ATL-HPA051712) Datasheet (External Link)
Vendor Page Anti FAM32A pAb (ATL-HPA051712)