Anti FAM24B pAb (ATL-HPA052490)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052490-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM24B
Alternative Gene Name: AC073585.2, MGC45962
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030858: 52%, ENSRNOG00000026419: 39%
Entrez Gene ID: 196792
Uniprot ID: Q8N5W8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TESCPALQCCEGYRMCASFDSLPPCCCDINEGL |
| Gene Sequence | TESCPALQCCEGYRMCASFDSLPPCCCDINEGL |
| Gene ID - Mouse | ENSMUSG00000030858 |
| Gene ID - Rat | ENSRNOG00000026419 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM24B pAb (ATL-HPA052490) | |
| Datasheet | Anti FAM24B pAb (ATL-HPA052490) Datasheet (External Link) |
| Vendor Page | Anti FAM24B pAb (ATL-HPA052490) at Atlas Antibodies |
| Documents & Links for Anti FAM24B pAb (ATL-HPA052490) | |
| Datasheet | Anti FAM24B pAb (ATL-HPA052490) Datasheet (External Link) |
| Vendor Page | Anti FAM24B pAb (ATL-HPA052490) |