Anti FAM240C pAb (ATL-HPA073342)

Atlas Antibodies

Catalog No.:
ATL-HPA073342-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description:
Gene Name: FAM240C
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054976: 38%, ENSRNOG00000023765: 38%
Entrez Gene ID: 285095
Uniprot ID: A0A1B0GVR7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA
Gene Sequence RSALNKLRVGWAEQLEGRNKMLQGPGRCPDRVPEATESLHTKDKKAA
Gene ID - Mouse ENSMUSG00000054976
Gene ID - Rat ENSRNOG00000023765
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM240C pAb (ATL-HPA073342)
Datasheet Anti FAM240C pAb (ATL-HPA073342) Datasheet (External Link)
Vendor Page Anti FAM240C pAb (ATL-HPA073342) at Atlas Antibodies

Documents & Links for Anti FAM240C pAb (ATL-HPA073342)
Datasheet Anti FAM240C pAb (ATL-HPA073342) Datasheet (External Link)
Vendor Page Anti FAM240C pAb (ATL-HPA073342)