Anti FAM228B pAb (ATL-HPA052598)

Atlas Antibodies

Catalog No.:
ATL-HPA052598-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 228, member B
Gene Name: FAM228B
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024073: 27%, ENSRNOG00000015249: 28%
Entrez Gene ID: 375190
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDLKPLARAPYLLESQEEEKTVIYKNKGSSFLEREPLCYQEGNNPSAKEAISEGYFSSLSLSRNGRKTRMGLP
Gene Sequence FDLKPLARAPYLLESQEEEKTVIYKNKGSSFLEREPLCYQEGNNPSAKEAISEGYFSSLSLSRNGRKTRMGLP
Gene ID - Mouse ENSMUSG00000024073
Gene ID - Rat ENSRNOG00000015249
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM228B pAb (ATL-HPA052598)
Datasheet Anti FAM228B pAb (ATL-HPA052598) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA052598) at Atlas Antibodies

Documents & Links for Anti FAM228B pAb (ATL-HPA052598)
Datasheet Anti FAM228B pAb (ATL-HPA052598) Datasheet (External Link)
Vendor Page Anti FAM228B pAb (ATL-HPA052598)