Anti FAM222A pAb (ATL-HPA058774)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058774-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: FAM222A
Alternative Gene Name: C12orf34, FLJ14721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041930: 86%, ENSRNOG00000001198: 84%
Entrez Gene ID: 84915
Uniprot ID: Q5U5X8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA |
| Gene Sequence | QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA |
| Gene ID - Mouse | ENSMUSG00000041930 |
| Gene ID - Rat | ENSRNOG00000001198 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FAM222A pAb (ATL-HPA058774) | |
| Datasheet | Anti FAM222A pAb (ATL-HPA058774) Datasheet (External Link) |
| Vendor Page | Anti FAM222A pAb (ATL-HPA058774) at Atlas Antibodies |
| Documents & Links for Anti FAM222A pAb (ATL-HPA058774) | |
| Datasheet | Anti FAM222A pAb (ATL-HPA058774) Datasheet (External Link) |
| Vendor Page | Anti FAM222A pAb (ATL-HPA058774) |