Anti FAM222A pAb (ATL-HPA058774)

Atlas Antibodies

Catalog No.:
ATL-HPA058774-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 222 member A
Gene Name: FAM222A
Alternative Gene Name: C12orf34, FLJ14721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041930: 86%, ENSRNOG00000001198: 84%
Entrez Gene ID: 84915
Uniprot ID: Q5U5X8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
Gene Sequence QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
Gene ID - Mouse ENSMUSG00000041930
Gene ID - Rat ENSRNOG00000001198
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM222A pAb (ATL-HPA058774)
Datasheet Anti FAM222A pAb (ATL-HPA058774) Datasheet (External Link)
Vendor Page Anti FAM222A pAb (ATL-HPA058774) at Atlas Antibodies

Documents & Links for Anti FAM222A pAb (ATL-HPA058774)
Datasheet Anti FAM222A pAb (ATL-HPA058774) Datasheet (External Link)
Vendor Page Anti FAM222A pAb (ATL-HPA058774)