Anti FAM222A pAb (ATL-HPA058774)

Atlas Antibodies

Catalog No.: ATL-HPA058774-25

Protein Description: family with sequence similarity 222 member A
Gene Name: FAM222A
Alternative Gene Name: C12orf34, FLJ14721
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041930: 86%, ENSRNOG00000001198: 84%
Entrez Gene ID: 84915
Uniprot ID: Q5U5X8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
• Gene Sequence: QPLRAYSGSTVASKSPEACGGRAYERASGSPLNCGVGLPTSFTVGQYFAAPWNSVLVTPTSDCYNPA
• Gene ID - Mouse: ENSMUSG00000041930
• Gene ID - Rat: ENSRNOG00000001198
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.