Anti FAM221B pAb (ATL-HPA026577)

Atlas Antibodies

SKU: ATL-HPA026577-25

• 

Protein Description: family with sequence similarity 221, member B
Gene Name: FAM221B
Alternative Gene Name: C9orf128
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028718: 34%, ENSRNOG00000025453: 38%
Entrez Gene ID: 392307
Uniprot ID: A6H8Z2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETP
• Gene Sequence: IIEEPHITMDAEKHPPSKDPSAEDLQENHISESFLKPSTSETPLEPHTSESPLVPSPSQIPLEAHSPETHQEPSISETP
• Gene ID - Mouse: ENSMUSG00000028718
• Gene ID - Rat: ENSRNOG00000025453
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.