Anti FAM221A pAb (ATL-HPA026748 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA026748-25

• 
• 

Protein Description: family with sequence similarity 221, member A
Gene Name: FAM221A
Alternative Gene Name: C7orf46, DKFZp686F0810, FLJ45875, MGC72075
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047115: 63%, ENSRNOG00000009447: 67%
Entrez Gene ID: 340277
Uniprot ID: A4D161
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATK
• Gene Sequence: DSPFLKAFQASSSSSPETLTDVGTSSQVSSLRRPEEDDMAFFERRYQERMKMEKAAKWKGKAPLPSATK
• Gene ID - Mouse: ENSMUSG00000047115
• Gene ID - Rat: ENSRNOG00000009447
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.