Anti FAM219B pAb (ATL-HPA058064)

Atlas Antibodies

Catalog No.:
ATL-HPA058064-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: family with sequence similarity 219, member B
Gene Name: FAM219B
Alternative Gene Name: C15orf17, FLJ00005
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032305: 93%, ENSRNOG00000054468: 91%
Entrez Gene ID: 57184
Uniprot ID: Q5XKK7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSD
Gene Sequence AKLQKHRDLAKAVLRRKGMLGASPNRPDSSGKRSVKFNKGYTALSQSPDENLVSLDSD
Gene ID - Mouse ENSMUSG00000032305
Gene ID - Rat ENSRNOG00000054468
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti FAM219B pAb (ATL-HPA058064)
Datasheet Anti FAM219B pAb (ATL-HPA058064) Datasheet (External Link)
Vendor Page Anti FAM219B pAb (ATL-HPA058064) at Atlas Antibodies

Documents & Links for Anti FAM219B pAb (ATL-HPA058064)
Datasheet Anti FAM219B pAb (ATL-HPA058064) Datasheet (External Link)
Vendor Page Anti FAM219B pAb (ATL-HPA058064)