Anti FAM219A pAb (ATL-HPA019338)

Atlas Antibodies

SKU: ATL-HPA019338-25

• 
• 

Protein Description: family with sequence similarity 219, member A
Gene Name: FAM219A
Alternative Gene Name: bA573M23.5, C9orf25, FLJ39031
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028439: 74%, ENSRNOG00000039559: 72%
Entrez Gene ID: 203259
Uniprot ID: Q8IW50
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM
• Gene Sequence: MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELARKGSLKNGSM
• Gene ID - Mouse: ENSMUSG00000028439
• Gene ID - Rat: ENSRNOG00000039559
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.